Protein Info for DZA65_RS12950 in Dickeya dianthicola ME23

Annotation: phage shock protein operon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02974: psp operon transcriptional activator" amino acids 8 to 325 (318 residues), 535.7 bits, see alignment E=2.4e-165 PF00158: Sigma54_activat" amino acids 9 to 170 (162 residues), 205.2 bits, see alignment E=1.5e-64 PF14532: Sigma54_activ_2" amino acids 9 to 179 (171 residues), 75 bits, see alignment E=1.8e-24 PF07728: AAA_5" amino acids 31 to 151 (121 residues), 26.9 bits, see alignment E=1.1e-09 PF02954: HTH_8" amino acids 289 to 319 (31 residues), 28.8 bits, see alignment (E = 2e-10)

Best Hits

Swiss-Prot: 74% identical to PSPF_ECOLI: Psp operon transcriptional activator (pspF) from Escherichia coli (strain K12)

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 95% identity to ddd:Dda3937_03115)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D588 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DZA65_RS12950 phage shock protein operon transcriptional activator (Dickeya dianthicola ME23)
MAHEQESLLGEANSFLEVLEQVSQLAQLSKPVLVIGERGTGKELIASRLHYLSPRWQGPF
ISLNCAALNENLLDSELFGHEAGAFTGAQKRHLGRFERADGGTLFLDELATAPMLVQEKL
LRVIEYGVLERVGGGQSLQVDVRLVCATNEDLPALAEQGKFRADLLDRLAFDVVHLPPLR
QRQQDIMLLAQHFAVQMCRELGLPLFPGFSPQAERSLLDYAWPGNIRELKNVVERSLYRH
GDNRDPVDRIILNPFKPLAAFATEQETAAASASFPALPLDLRGWQHTQERQLVQQALAQA
RFNQRKAAELLGVTYHQFRGLLKKHAIGVDDPPPFLPTTPSVR