Protein Info for DZA65_RS12935 in Dickeya dianthicola ME23

Annotation: envelope stress response membrane protein PspC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 transmembrane" amino acids 35 to 61 (27 residues), see Phobius details PF04024: PspC" amino acids 7 to 65 (59 residues), 65.2 bits, see alignment E=1.8e-22 TIGR02978: phage shock protein C" amino acids 7 to 119 (113 residues), 125 bits, see alignment E=7.7e-41

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 92% identity to ddd:Dda3937_03118)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPX7 at UniProt or InterPro

Protein Sequence (119 amino acids)

>DZA65_RS12935 envelope stress response membrane protein PspC (Dickeya dianthicola ME23)
MNARFDRKLYRLPEEGMIKGVCAGLARYFDVPVRLVRIIAVLSIFFGLFLITAVAYLILS
FMLDPAPPEAYPPAETGVSPNALLDQADAILSASEQRLRHIERYITSDTYSLRSKFRQL