Protein Info for DZA65_RS12920 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 448 (429 residues), 103.9 bits, see alignment E=1e-33 PF07690: MFS_1" amino acids 58 to 307 (250 residues), 61.7 bits, see alignment E=6e-21 amino acids 301 to 440 (140 residues), 40.6 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 91% identity to dze:Dd1591_1759)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY96 at UniProt or InterPro

Protein Sequence (448 amino acids)

>DZA65_RS12920 MFS transporter (Dickeya dianthicola ME23)
MATRIDALPSSWGLWRFIMLLSLGGFFELYDLFQTAYISTGLIGEKIFHVGKDGLLGVSD
QATFASATFFGLFIGASLLAPQADRLGRRGAFMFALAWYGAFSLLMAFQTQAEWVILCRF
LVGIGLGVELVTIDTYLSEWAPTHLRSQAFALAFFMQFLSVPTVALMSWWLVPQTFWGLS
GWRYVVIIGAVCSLVVWLLRRNLMESARWLASRGRYREAEKVMTEMEHRCGVPPGRALEP
QTAITLPSRGRFLDIWSVRYRRRTLMLMVMNIFQAIGFFGFGNWLPALLAGRGATVTHSL
LYAFFITLAYPLGSLLCSGYAGKLENKWQIVLSSLMTVVFGTLFAFQTQPLWLIVCGFLI
TYSNAWLTISYHAYQTEIFPTAIRARGVGFCYSFSRLSTAFSSIVIGLILQHYDTSGVLA
FIIISMLTVVVTVGVFGPRTRGVRLENI