Protein Info for DZA65_RS12880 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details amino acids 434 to 457 (24 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 416 (398 residues), 140.8 bits, see alignment E=5.3e-45 PF00083: Sugar_tr" amino acids 37 to 188 (152 residues), 34.1 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03133)

Predicted SEED Role

"Probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPI8 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DZA65_RS12880 MFS transporter (Dickeya dianthicola ME23)
MKQGPLSQTLTGIGLMVLLTGQLLPMIDFSIVNVALEAIAHSLSASSAELELVVSVYGVA
FAVSLAMGGRLGDNLGRRRVFIAGVALFGVASLLCGIAQAVWVLLAARALQGISAALVVP
QILATIHVCLRGREHARALGFYSAIGGLAFVVGQVLGGFLIQLDIAGYGWRSVFLVNLPV
CLLVLLWAPSRLPDTRGEKPVALDMPGTVLLSLMLASLLFPLALGPIWHWPWFCVAALLS
SLVWFALLWRVERRQSAPLLPPALFRLPGIRFGLLLALLFFSSWSGFMFAVAYTLQSGAG
FTPLQSGNSFIGLGLSYFVASLFSGRLAARIGTVGALLAGCAIQMSGLALLMASLAWRWP
VSVLQLLPATMMIGFGQAFIVSSFYRIGLSDVPTHQAGAGSALLSTMQQASLGLGPIVLG
TVLVQVLHASGGQFAGALIATLMAEWALMLVLVLCALRNRLALVHPRPTV