Protein Info for DZA65_RS12805 in Dickeya dianthicola ME23

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF02525: Flavodoxin_2" amino acids 2 to 197 (196 residues), 178.5 bits, see alignment E=1.4e-56 PF03358: FMN_red" amino acids 3 to 176 (174 residues), 46.7 bits, see alignment E=2.7e-16

Best Hits

Swiss-Prot: 82% identical to AZOR_PECAS: FMN-dependent NADH-azoreductase (azoR) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 95% identity to dze:Dd1591_1782)

MetaCyc: 74% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0I0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>DZA65_RS12805 FMN-dependent NADH-azoreductase (Dickeya dianthicola ME23)
MSKVLVLKSSILADFSQSNQMADHFTASWQAAHPGDTITVRDLAAKPVPVLDGELVGALR
PSDKPLTPRQQDALALSDELIAELQAHDVIVLAAPMYNFNIPTQLKNYFDFIARAGVTFR
YTEQGPEGLVKGKRALVLTSRGGIHKGAPSDLLTPYLRLFLAFIGISDVEFVFAEGFGYG
PDVAQKALAGAKDELSQLASA