Protein Info for DZA65_RS12730 in Dickeya dianthicola ME23

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 18 to 44 (27 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 126 to 155 (30 residues), see Phobius details amino acids 191 to 206 (16 residues), see Phobius details amino acids 215 to 231 (17 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 60 (36 residues), 36 bits, see alignment 5.2e-13 PF00528: BPD_transp_1" amino acids 101 to 284 (184 residues), 110.8 bits, see alignment E=6.7e-36

Best Hits

Swiss-Prot: 43% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 94% identity to ddd:Dda3937_00114)

MetaCyc: 43% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPD3 at UniProt or InterPro

Protein Sequence (286 amino acids)

>DZA65_RS12730 ABC transporter permease subunit (Dickeya dianthicola ME23)
MHSCHTDRQPRRPAHGVAVLNSLNVCIVMLSLLTLIALFAPWLAPFDPYSQNVMHRLQPP
GPEHWLGTDGFGRDLLSRVIYGTRPALMMVALILVITIPIGLLIGVGAGYLGGWVDRLLM
RLTDIMLALPGLVIALALVAVLGAGLLHGALALALTAWPQFARQARAETMALRNSEFLAA
ARMQGIDGWRLMYGHVLPLCLPGALTRAAMTPGNMILAAAGLGFLGVGAPPPMAEWGAMV
AEGSSVMLEQWWVATMPGLAIFLTSLTFNLLGNALRDKLDPRYDKH