Protein Info for DZA65_RS12710 in Dickeya dianthicola ME23

Annotation: serine/threonine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00149: Metallophos" amino acids 20 to 157 (138 residues), 56.6 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 50% identical to PP_LAMBD: Serine/threonine-protein phosphatase from Escherichia phage lambda

KEGG orthology group: K07313, serine/threonine protein phosphatase 1 [EC: 3.1.3.16] (inferred from 88% identity to ddd:Dda3937_00109)

MetaCyc: 53% identical to phosphoprotein phosphatase 1 (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]; Phosphoprotein phosphatase. [EC: 3.1.3.48, 3.1.3.16]

Predicted SEED Role

"Ren protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.16 or 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY55 at UniProt or InterPro

Protein Sequence (228 amino acids)

>DZA65_RS12710 serine/threonine protein phosphatase (Dickeya dianthicola ME23)
MAIERQPLAYQHISGADWRHIFVVGDVHGCYRQLMTALDQVGFDTGSDLLVSVGDLIDRG
AQSLACLDLLPQRWFRAVRGNHEQMALDALNDTARIPLWRANGGDWFFRLDDERQALARR
LLALAAQLPYVIEIDTAGRRTVVAHADYPADCYQFDQPLCWEQVLWNRLRVKQAMAGVGG
PIIGADHFLFGHTPLRRVLTCWNLQYIDTGAVFGGELTLRCIQDGVDK