Protein Info for DZA65_RS12690 in Dickeya dianthicola ME23

Annotation: guanine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02967: guanine deaminase
  • amino acids 27 to 426 (400 residues), 615 bits, E=3e-189
• PF01979: Amidohydro_1
  • amino acids 68 to 428 (361 residues), 227.9 bits, E=2.1e-71
• PF07969: Amidohydro_3
  • amino acids 255 to 430 (176 residues), 51.8 bits, E=1e-17

Best Hits

Swiss-Prot: 64% identical to GUAD_ECOLI: Guanine deaminase (guaD) from Escherichia coli (strain K12)

KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 94% identity to ddd:Dda3937_04713)

MetaCyc: 64% identical to guanine deaminase (Escherichia coli K-12 substr. MG1655)
Guanine deaminase. [EC: 3.5.4.3]

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (9/11 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (4/6 steps found)
• purine nucleotides degradation I (plants) (8/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

See A0A3A4D5Z4 at UniProt or InterPro

Protein Sequence (438 amino acids)

>DZA65_RS12690 guanine deaminase (Dickeya dianthicola ME23)
MMETIRAYRASLLHFVADPLHDPQATRFIEDGLLRVRDGRIQDAVPYDSLTEAERQSMTV
TDYRGRLLMPGFIDTHIHFPQTEMIASYGEQLLSWLNTYTFPTERKFADEDYARERAAFF
IQELLRHGTTSALVFATVHPQSVDALFSAAEAKNMCLIAGKVMMDRHAPDYLCDTAQQSY
DESKALIEKWHRRGRLRYAVTPRFAPTSTPAQLAQAGRLLREYPDVYLHTHLSENPDEIA
WVKSLFPEHQHYLDVYHHHGLTGRRSVFAHAIHLQPDEIRTLAHSQSAVAFCPCSNLFLG
SGLFRLHPLKAAGIRIGIGTDVGAGTSLSLLQTLSDGYKVQQLQGEKLSAREGLYQATLG
GAAALSLDDRLGNFLPGKEADFVVLDWAATPLQQLRQQQSTSLDDRLFALMMQGDDRNIS
ATYVNGQCVYRRQTPDRN