Protein Info for DZA65_RS12600 in Dickeya dianthicola ME23

Annotation: baseplate assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF26776: Baseplate_J_N" amino acids 50 to 107 (58 residues), 104 bits, see alignment E=6e-34 PF26078: Baseplate_J_M" amino acids 137 to 209 (73 residues), 38.3 bits, see alignment E=2.2e-13 PF26079: Baseplate_J_C" amino acids 215 to 292 (78 residues), 51.4 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 73% identical to BPJ_BPP2: Baseplate protein J (J) from Escherichia phage P2

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_00030)

Predicted SEED Role

"Baseplate assembly protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7X4 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DZA65_RS12600 baseplate assembly protein (Dickeya dianthicola ME23)
MPLIDLSQLPAPSVVETLDYETLYATRKETLLSLYSAEERGAIARALTLESEPMVKLLQE
NAYRELLLRQRINEAAQAGMLAFAQGNDLDQLGANVNVSRLAIIPADATTVPPTAAVMES
DTDFRLRIQQAYEGLSVAGSIGAYQFHGRSASGQVADISVISPGPAQVLVSVLSRENDGT
ASDALLATVNAALNAEDVRPVADRVTVKSAVIVPYDINATLYLYPGPEVEPIRAAAEKKL
QSYVSSQHRLGRDIRRSAIYAALHVEGVQRVELARPAVDIVLDDTQASHCTGYTLTLGGT
DE