Protein Info for DZA65_RS12525 in Dickeya dianthicola ME23

Annotation: MCE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 876 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF02470: MlaD" amino acids 46 to 137 (92 residues), 63.4 bits, see alignment E=9.8e-22 amino acids 163 to 227 (65 residues), 32.5 bits, see alignment 4.1e-12 amino acids 280 to 369 (90 residues), 29.3 bits, see alignment E=4.2e-11 amino acids 393 to 453 (61 residues), 33.5 bits, see alignment 2e-12 amino acids 514 to 589 (76 residues), 27.6 bits, see alignment E=1.4e-10 amino acids 633 to 722 (90 residues), 43.3 bits, see alignment E=1.8e-15 amino acids 745 to 806 (62 residues), 42.2 bits, see alignment 3.8e-15

Best Hits

Swiss-Prot: 67% identical to YEBT_ECOLI: Intermembrane transport protein YebT (yebT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to dze:Dd1591_1841)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJP5 at UniProt or InterPro

Protein Sequence (876 amino acids)

>DZA65_RS12525 MCE family protein (Dickeya dianthicola ME23)
MQNQTPMTPTEANVKTRRRLSPFWLLPFIACLIAGWLLYTNQQERGATVTIDFGSADGIV
PGRTPVRYQGVEIGTVRNIKLSDDLRTIQVVASIRNDMKEALRSGTQFWLVTPKASLAGV
SGLDALVGGNYIGMLPGGGDPASHFTAQDTQPKYRVNSGELLIHLRADDLGSLNTGSLVY
FRKMPVGKVYDYSVNPDHSGVTIDVLIDRRFTGLVKKDSRFWNVSGLKADVSLSGATVEM
QNLSALVNGAIAFDSPEQGNAAAADQNYTLYPDLARSQRGVLITLDLPSGDKLRAGHTPL
LYQGLEVGTLQRIALEADQRVTGELIVDPSVVPLMRENTRIELAPPRLSLSDLNLTSLLG
GTTLTLIPGDGEPKRRFSVPDAAQQQRQQPGALTVELTAGQSYGIDSGQPVMLHGVQIGR
IVQRALTDNGVSFTAVIDPQYRHLLHKDSQFIASSRVNVKLGLDGVQVLGASAQEWLSGG
VTVLPGRTGDAQPRYPLYSDREKAGAGIQGVTPPTTLTLLTDSLPDIQEGSVVLYRKFQV
GEITRIRPKADTFDIDVYVRPEYRNLLTDNSVFWAEGGARVQLSGAGLTVQASPLSRALK
GAISFDNVEGAADVQGGKRPLYSNETAARAIGSRITLRTYDASKLSAGMPIRYLGIDIGQ
LESLKLAEQRDEVLVQAVLYPEYVRNFARAGTRFSVVTPEISAAGVNHLETLIQPYINVE
PGSGVVTRSFELQKATISDSRYQDGLSISVDTAEAGSLQIGTPVLFRGIEVGTVTGLSLG
SLSDRVSVALRISKRHAHLVRDNSVFWLASGYNLQFGLTGGVIKSGTFQQFIRGGIAFAT
PPATPLAPTAQAGKHFLLHGEEPGGWRDWGTALPER