Protein Info for DZA65_RS12510 in Dickeya dianthicola ME23

Annotation: RNA chaperone ProQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF04352: ProQ" amino acids 8 to 115 (108 residues), 141.5 bits, see alignment E=9.9e-46 PF17516: ProQ_C" amino acids 193 to 242 (50 residues), 82.7 bits, see alignment 9.2e-28

Best Hits

Swiss-Prot: 77% identical to PROQ_SERP5: RNA chaperone ProQ (proQ) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03607, ProP effector (inferred from 98% identity to dze:Dd1591_1844)

Predicted SEED Role

"ProQ: influences osmotic activation of compatible solute ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CEJ0 at UniProt or InterPro

Protein Sequence (243 amino acids)

>DZA65_RS12510 RNA chaperone ProQ (Dickeya dianthicola ME23)
MENQPKLNSSKEVIAYLAERFPLCFTLEGEARPLKIGIFQDLVERVSESEHVSKTQLRSA
LRLYTSSWRYLYGVKLGAQRVDLDGNPCGELEQQHVEHARQQLEEAKARVQAQRAEQQAK
KRESGEAEPSRPRPAAGRNAPRRERDAAGAAPRKPRPSSSRSAQTASPSSEKSQPRQPKA
ARAVQPERQAVTDISSLQIGQEIKVRAGKSAMDATVLEIAKDGVRVQLASGLAMIVRAEH
LQF