Protein Info for DZA65_RS12395 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13416: SBP_bac_8" amino acids 41 to 294 (254 residues), 158 bits, see alignment E=6.8e-50 PF01547: SBP_bac_1" amino acids 52 to 280 (229 residues), 46 bits, see alignment E=1.1e-15 PF13343: SBP_bac_6" amino acids 90 to 294 (205 residues), 37.1 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00641)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CIV4 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DZA65_RS12395 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MLKKFALSALLVALASQSWAENLTVISFGGTNKDAQDKAFYKPFQAAGKGAIEAGEYNGE
MARIRAMVQTGQVGWDVVEVEGPELLRGCNEGLFEPLDWKKLGNQADFVKGAVSECGAGI
FVWSTVLTYNANKLQQAPKSWVDFWDVKNFPGKRALRKSAKFTLEIALLADGVKREEVYT
VLATPAGVDRAFKKLDQIKSNIQWWESGAQPLQWLVAGDVVMTSAYNGRVAVAQKEKPGI
NIVWKDGLYDLDSWAIVKGSKHKALAEQFIAFANQPENQKVFAENIAYGPTNGKTTALLD
PAISRNLPTAPDNLVQSVQVDTEFWIEHGEELEQRFNAWAAQK