Protein Info for DZA65_RS12375 in Dickeya dianthicola ME23

Annotation: histidinol-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 95 to 112 (18 residues), see Phobius details TIGR02067: histidinol-phosphatase" amino acids 8 to 261 (254 residues), 283.1 bits, see alignment E=1e-88 PF00459: Inositol_P" amino acids 11 to 256 (246 residues), 150.6 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddc:Dd586_1855)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFR4 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS12375 histidinol-phosphatase (Dickeya dianthicola ME23)
MSQSLPDIAFFHRLADAASQQTLPRFRSQQNLHVGSKPKEGFRFDPVTDADREAERVIRA
LITEHYPEHAIMGEEFGTTGSGDVQWVLDPVDGTRPFLCGLPVWGTLIGLLYRERAVMGM
MSQPFTGEAFWADGQHAWYRGPQGESRMETRKNVMLDQAILHTTSPEPIERHPQVHFRDL
TERTLMTRYGGECYAMAMLAAGHIDICLEYSLQPYDIAAFIPIVEQAGGVVTTLQGTRPE
AGGQILATGCPRLHEDVLRILNG