Protein Info for DZA65_RS12340 in Dickeya dianthicola ME23

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01891: amidohydrolase" amino acids 15 to 381 (367 residues), 346.2 bits, see alignment E=1.2e-107 PF01546: Peptidase_M20" amino acids 75 to 390 (316 residues), 149.8 bits, see alignment E=1e-47 PF07687: M20_dimer" amino acids 187 to 267 (81 residues), 21.2 bits, see alignment E=2.3e-08

Best Hits

Swiss-Prot: 43% identical to ILL7_ORYSJ: IAA-amino acid hydrolase ILR1-like 7 (ILL7) from Oryza sativa subsp. japonica

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 94% identity to ddc:Dd586_1862)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2Z5 at UniProt or InterPro

Protein Sequence (400 amino acids)

>DZA65_RS12340 amidohydrolase (Dickeya dianthicola ME23)
MADYEQTLRQIIPVLTGIRRHIHQHPEIGFEEFGTAALVAEKLREWGLEVSTGIGGTGVV
GTLRGKQPGEGVIGLRADMDALRLQEKTGLPHASVYDGKMHACGHDGHTAMLLGAAWLLS
RHPDFAGTVHFIFQPAEEGLGGARAMLDDGLLSRFPCQRLFGLHNKPGIALGRFSLRSGP
MLCASDSWRVVFCGTGGHGGSGAHLSIDPTLPAAQFVLALQTVVSRNVPAMEAAVLSVGH
IGGGDPLAPNVIPERVTVTGTGRSYSPAIRELLAKRLTVLAQHSAQAFGATAEVNYEFQY
PVLVNEREMAGRAKQAAERVSGADAVDGEMTPLLGAEDFAYLLEQRPGAFIMAGNGADDD
AHGRPLHTPHYDFNDALIPVGVRYWVELVRQELPLTGGIA