Protein Info for DZA65_RS12310 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00005: ABC_tran" amino acids 24 to 181 (158 residues), 127.3 bits, see alignment E=6.8e-41 PF13304: AAA_21" amino acids 149 to 211 (63 residues), 29.6 bits, see alignment E=7.6e-11

Best Hits

Swiss-Prot: 51% identical to HISP_ECOLI: Histidine transport ATP-binding protein HisP (hisP) from Escherichia coli (strain K12)

KEGG orthology group: K10010, cystine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 97% identity to ddd:Dda3937_00631)

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y075 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DZA65_RS12310 amino acid ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MTDSQDIVLRLRGLTKSFHGQPVLKGIDLDVRRGEKIAIIGGSGSGKSTLLRCLNFMEVP
SGGTIELDGEVLGQPLPDGARRYAEKQLCAVRQRVGMVFQQFNLFPHLTVLQNVQEALLS
VKKLPRADAAVIARRQLEKVGLVDKLNARPGNLSGGQQQRVAIARALAMEPEIMLFDEPT
SSLDPELVGEVLHTIRALADDGRTLLLVTHELGFAWHFADRVIFIADGVIHEMGSAEQVL
RHPQQPRTQAFLARFAERAF