Protein Info for DZA65_RS12280 in Dickeya dianthicola ME23

Annotation: transporter substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 39 to 255 (217 residues), 67.7 bits, see alignment E=4.5e-23

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00627)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CEE7 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DZA65_RS12280 transporter substrate-binding domain-containing protein (Dickeya dianthicola ME23)
MHLSFRTMIAALALVAAPWLAQAEAPASTWQHIKQTGELRIGVAQGEPWYFKNAATGEWD
GIGYQVGKVLATDLGVKLVTVETTWGNAVAALQTGQIDTMLVLDPTDERKKAVDFPAQPF
FWYAQGVLVRDGITVTDWEDLNQPDVKIGVTLGSSPDLLLTKNLPKAQLVRFPNMDEGVA
AFYAGRVDALSYFHPALALQQAKVGKGNLILPKPIVAVSTSGAIRKESDQTFHQFLNDEF
GKLYQSGQIQQFYEQALKARGVDISKVPPVIREAWK