Protein Info for DZA65_RS12260 in Dickeya dianthicola ME23

Annotation: peptide antibiotic transporter SbmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details PF05992: SbmA_BacA" amino acids 80 to 394 (315 residues), 560 bits, see alignment E=1.8e-172 PF06472: ABC_membrane_2" amino acids 94 to 283 (190 residues), 44.7 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 69% identical to SBMA_ECOLI: Peptide antibiotic transporter SbmA (sbmA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_00623)

MetaCyc: 69% identical to peptide antibiotic/peptide nucleic acid transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-205A

Predicted SEED Role

"SbmA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DUI9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>DZA65_RS12260 peptide antibiotic transporter SbmA (Dickeya dianthicola ME23)
MFKSFFPNPKLFFSSALLWSLVVVVIWYSWGRPLGDSLLHISQPLPQGAIRFLSPAFLWF
YGYYALCVGIFASAWALLNPHPWQRWSILGSSLIVFVTYFSVEVGVAVNDWYVPFYDLIQ
KALSAPNAVTIQAFYQQLLIFLGIALTAVTVGVLNLFFVSHYVFRWRTAMNDYYTSHWQT
LRHIEGAAQRIQEDTMRFASTVESLGVDLVKSLMTLIAFLPVLVSLSSHVKSLPLIGEIP
YGLVIAAIVWSLAGTSLLALIGIKLPGLEFNNQRVEAAYRKELVYGEDDAGRAAPPTVKQ
LFKGVRKNYFRLYFHYTYFNIARVLYLQTDNVFGIIMLLPSIVAGSLTLGLMTQITNVFD
QVRGSFQYLINSWTTIVELMSIYKRLRSFESVIQDVPMTIDAADVTSGA