Protein Info for DZA65_RS12255 in Dickeya dianthicola ME23

Annotation: type III secretion system export apparatus subunit SctU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 2 to 346 (345 residues), 404.8 bits, see alignment E=1.7e-125 PF01312: Bac_export_2" amino acids 3 to 342 (340 residues), 309.3 bits, see alignment E=1.8e-96

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 94% identity to ddd:Dda3937_00618)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYX4 at UniProt or InterPro

Protein Sequence (359 amino acids)

>DZA65_RS12255 type III secretion system export apparatus subunit SctU (Dickeya dianthicola ME23)
MSEKTEKPTAKKLQDARKKGEVGQSQDVPKLLISFALLEMILALADSGMGKLQALMQLPL
SRITDPFGHAADEIFSDALSLLATFCLLTISVALLMRVVGGWIQYGPLFAVEALKIDFNR
LNPVNQIKQMFTLRKLTDMLTNILKAVTIGLVFWLVVIPQLEWLVELAYGDLTAFWKGVE
SVLKSVARTTLSALLAMGVLDFGLQKFYFLKQQRMSHEDIRNEFKNSEGDPHMKGHRKSV
AQEILNEPASPRAKPKVEDADLLLVNPTHYAVALFYRPGKTPLPRILLKGEDDQAKALIA
RAHQAGVPVIRFIWLARTLYRIPEGHYIPRNTLQPVAQVYRVLRQLEKDLPQREVIELG