Protein Info for DZA65_RS12215 in Dickeya dianthicola ME23

Annotation: type III secretion system inner membrane ring subunit SctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 151 to 173 (23 residues), see Phobius details PF16697: Yop-YscD_cpl" amino acids 5 to 95 (91 residues), 64.7 bits, see alignment E=1.2e-21 PF00498: FHA" amino acids 23 to 59 (37 residues), 22.9 bits, see alignment 1.4e-08 TIGR02500: type III secretion apparatus protein, YscD/HrpQ family" amino acids 199 to 320 (122 residues), 90.5 bits, see alignment E=5.7e-30 PF16693: Yop-YscD_ppl" amino acids 200 to 318 (119 residues), 30.7 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: K03220, type III secretion protein SctD (inferred from 91% identity to ddd:Dda3937_00610)

Predicted SEED Role

"type III secretion protein HrpQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXW7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DZA65_RS12215 type III secretion system inner membrane ring subunit SctD (Dickeya dianthicola ME23)
MFELRVLTGLHRGAALPLSGTSWRIGSADEADMVLYDPGIREQHCLLEKQPDGWWVSVLD
GPVSNSEGHAATQPLALPPGTPFAAGGIWLCVVSADTPWQDEAEEPPPDDVLVADDAATG
AEAPPPDASDTLRAPTPEPLATRREKGRLPLWAKFSYLLLAVLLFMIVGSWMLQETAAMP
STPPSQDNRLPIGTLPQLNSTLQTMLTDRELEQLVSASQENNRIVLSGALLPAQHTRLAR
MLAQFHQRYVTALQIENHTTVKNDQLPFQIVQVTSGPKANVVTSDGRRIFVGDEVDNLRL
VSINDSQIEFRGKQQIKVNW