Protein Info for DZA65_RS12160 in Dickeya dianthicola ME23

Annotation: type III secretion system stator protein SctL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF06188: HrpE" amino acids 1 to 191 (191 residues), 306 bits, see alignment E=5.5e-96 TIGR02499: type III secretion apparatus protein, HrpE/YscL family" amino acids 19 to 182 (164 residues), 163 bits, see alignment E=3.3e-52

Best Hits

KEGG orthology group: K03223, type III secretion protein SctL (inferred from 90% identity to ddd:Dda3937_03340)

Predicted SEED Role

"Type III secretion cytoplasmic protein (YscL)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DUK7 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DZA65_RS12160 type III secretion system stator protein SctL (Dickeya dianthicola ME23)
MLTRRCLKLVAGTDVQEAELIRVEQLQQHQRGLAVMADARQQADALLDEARRQAHEAIAI
ATGQAERQFWQQADELLRGWQQEREQMESWLVAQCGQLLTDAMTRILKTVPDAERYPALL
RQLLRTQGGEGRGTLYCHPERQAEVAAWLTEHSHLGWRLVSDDALAHDTLKLLTAQGVMT
LSWQRAVEQLLPQAQTLSLH