Protein Info for DZA65_RS12105 in Dickeya dianthicola ME23

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF00190: Cupin_1" amino acids 35 to 121 (87 residues), 38.3 bits, see alignment E=1e-13 PF07883: Cupin_2" amino acids 40 to 111 (72 residues), 46.3 bits, see alignment E=2.8e-16

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_04153)

Predicted SEED Role

"Cupin 2, conserved barrel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYK7 at UniProt or InterPro

Protein Sequence (131 amino acids)

>DZA65_RS12105 cupin domain-containing protein (Dickeya dianthicola ME23)
MTNQLKIVRPDHATDTSQKLPYFVGISRDTVGAKHISMNMVVIPAGAQAEPHYHVDYETA
IYLVKGRVETRYGTDLSQTCLHLAGEFLYIPPGVPHQPRNLSDEEDAIAIVARNDANERE
NVRLYPVDDSE