Protein Info for DZA65_RS12045 in Dickeya dianthicola ME23

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF13560: HTH_31" amino acids 15 to 74 (60 residues), 49.5 bits, see alignment E=8.9e-17 PF12844: HTH_19" amino acids 18 to 74 (57 residues), 32.8 bits, see alignment E=1e-11 PF13443: HTH_26" amino acids 19 to 77 (59 residues), 27.7 bits, see alignment E=5.3e-10 PF01381: HTH_3" amino acids 20 to 74 (55 residues), 63.2 bits, see alignment E=3.7e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to ypy:YPK_1628)

Predicted SEED Role

"RstR phage-related transcriptional repressor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CK05 at UniProt or InterPro

Protein Sequence (133 amino acids)

>DZA65_RS12045 helix-turn-helix transcriptional regulator (Dickeya dianthicola ME23)
MSHVDSLCAGMDMSAFAERLRLLREARNLSQVRLSELLGVDPRAYNRWEKGATAPHLDTV
IKIADVLQVTLDELVGRRPVSEEVKIRNHTLHALWQKADLLPDSDQQALIAVLDSFVKKS
MVEQVIGFNSNRR