Protein Info for DZA65_RS12020 in Dickeya dianthicola ME23

Annotation: ribonuclease toxin immunity protein CdiI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF18624: CdiI_4" amino acids 15 to 116 (102 residues), 117.6 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 62% identical to CDII_ECOST: Immunity protein CdiI (cdiI) from Escherichia coli (strain STEC_O31)

KEGG orthology group: None (inferred from 85% identity to dze:Dd1591_1926)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C6N3 at UniProt or InterPro

Protein Sequence (121 amino acids)

>DZA65_RS12020 ribonuclease toxin immunity protein CdiI (Dickeya dianthicola ME23)
MSQELFGQPYDNNDPHWIIKAYFDRMYNDGYFGKAISYILHKDSFHVDGAYCSFPDMNSY
YEEEHFEGVEFAYGYPPEEDDTIIVSEETCFKYVRLACERYLQKHPEDESKIKALLEKMP
L