Protein Info for DZA65_RS11710 in Dickeya dianthicola ME23

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF07883: Cupin_2" amino acids 35 to 95 (61 residues), 40.3 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 99% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 99% identity to dze:Dd1591_1973)

MetaCyc: 82% identical to unsaturated pyranuronate lyase monomer (Yersinia enterocolitica)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]

Predicted SEED Role

"Pectin degradation protein KdgF" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CLJ9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>DZA65_RS11710 cupin domain-containing protein (Dickeya dianthicola ME23)
MRRYFIDDETPWEELGDGIKRKIITWSDELMMVCVHFAKGAIGTPHKHDIHDQIAYVAAG
SFEVVIEGEKRILKTGDAYMAVKNEMHGVVSLEEGSVLIDTFSPKRADFL