Protein Info for DZA65_RS11690 in Dickeya dianthicola ME23

Annotation: transcription antiterminator/RNA stability regulator CspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 PF00313: CSD" amino acids 5 to 68 (64 residues), 114.3 bits, see alignment E=9.1e-38

Best Hits

Swiss-Prot: 96% identical to CSPC_ECOLW: Cold shock-like protein CspC (cspC) from Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 96% identity to eay:EAM_1967)

Predicted SEED Role

"Cold shock protein CspC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DG38 at UniProt or InterPro

Protein Sequence (69 amino acids)

>DZA65_RS11690 transcription antiterminator/RNA stability regulator CspE (Dickeya dianthicola ME23)
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PSAVNVVAL