Protein Info for DZA65_RS11685 in Dickeya dianthicola ME23

Annotation: 23S rRNA (guanine(745)-N(1))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF21302: Zn_ribbon_RlmA" amino acids 3 to 45 (43 residues), 76.1 bits, see alignment 5.7e-25 PF13489: Methyltransf_23" amino acids 72 to 135 (64 residues), 28.2 bits, see alignment E=5e-10 PF01209: Ubie_methyltran" amino acids 83 to 153 (71 residues), 20.7 bits, see alignment E=8.2e-08 PF13847: Methyltransf_31" amino acids 88 to 154 (67 residues), 40.9 bits, see alignment E=6.5e-14 PF08242: Methyltransf_12" amino acids 89 to 139 (51 residues), 33.1 bits, see alignment 2.8e-11 PF08241: Methyltransf_11" amino acids 89 to 161 (73 residues), 39.5 bits, see alignment E=2.5e-13 PF13649: Methyltransf_25" amino acids 89 to 158 (70 residues), 44.9 bits, see alignment E=5.6e-15

Best Hits

Swiss-Prot: 58% identical to RLMA_ECOLI: 23S rRNA (guanine(745)-N(1))-methyltransferase (rlmA) from Escherichia coli (strain K12)

KEGG orthology group: K00563, 23S rRNA (guanine745-N1)-methyltransferase [EC: 2.1.1.187] (inferred from 92% identity to ddd:Dda3937_00016)

MetaCyc: 58% identical to 23S rRNA m1G745 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11573 [EC: 2.1.1.187]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase A (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.187 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXT2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DZA65_RS11685 23S rRNA (guanine(745)-N(1))-methyltransferase (Dickeya dianthicola ME23)
MPYQCPLCHQPLNVESGRWSCGRHHFDRARDGYVNLLPVQFKRSRQPGDSAEMMQARRAF
LDNGHYQPLRDRVSEQLAALLQMQPGALLDIGCGEGYYTAALADKLTPQGMAVYGLDVSR
AAIQRAAKRYAQVLFCVASSQRLPFQDHSLAAVLKIYAPCNGDELARVIWPGGGLMTVSP
GPNHLLSLKARVYQEVRPHPNVDEAFPGFALEAVERLQYRMVMTGADAASLLQMTPFAWR
ATPDVSKGLMALEQFECETDFLIRFHRRDG