Protein Info for DZA65_RS11610 in Dickeya dianthicola ME23

Annotation: Slp family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00752: outer membrane lipoprotein, Slp family" amino acids 10 to 179 (170 residues), 192.1 bits, see alignment E=2.9e-61 PF03843: Slp" amino acids 19 to 166 (148 residues), 163.9 bits, see alignment E=9.2e-53

Best Hits

Swiss-Prot: 56% identical to YEAY_ECOLI: Uncharacterized lipoprotein YeaY (yeaY) from Escherichia coli (strain K12)

KEGG orthology group: K07285, outer membrane lipoprotein (inferred from 95% identity to ddd:Dda3937_03714)

Predicted SEED Role

"Starvation lipoprotein Slp paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7N6 at UniProt or InterPro

Protein Sequence (194 amino acids)

>DZA65_RS11610 Slp family lipoprotein (Dickeya dianthicola ME23)
MRLRRVGLCGLLLLSLAGLSGCVTLPAEIRGTSATPQMDLIRVMNAPNLYVGQESRFGGR
IADIRNEANRTRLEIVSLPLDEAGRPRLDEPSEGRLVAYVNGFLEPVEFKNQLITVVGPI
TGAEQGKIGERPYQYVVVSVQGYKRWRVVQQVMLPPRAYDPWWDHRYRHVWGPGWGPGWN
DGYAPAQVESVVTE