Protein Info for DZA65_RS11345 in Dickeya dianthicola ME23

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00080: Sod_Cu" amino acids 39 to 173 (135 residues), 107.2 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 64% identical to SODC1_SALTY: Superoxide dismutase [Cu-Zn] 1 (sodC1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 94% identity to ddd:Dda3937_01629)

MetaCyc: 56% identical to superoxide dismutase (Cu-Zn) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXH4 at UniProt or InterPro

Protein Sequence (174 amino acids)

>DZA65_RS11345 superoxide dismutase (Dickeya dianthicola ME23)
MKLKALILSSLFVSAVASAASTTVTLKEALPTGDGNTLGDITITETEYGLLFSPNLKGLQ
PGIHGFHVHANASCAPGEQNGNKVPALAAGGHLDPQKTGRHLGPYNDKGHLGDLPGLVVN
ADGATSYEVLAPRLKSLSEVKNHALMIHTGGDNYADTPKDLGGGGMRIACGVIQ