Protein Info for DZA65_RS11330 in Dickeya dianthicola ME23
Annotation: phenolic acid decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to PADC_VIBCH: Probable phenolic acid decarboxylase (padC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K13727, phenolic acid decarboxylase [EC: 4.1.1.-] (inferred from 96% identity to dze:Dd1591_2088)Predicted SEED Role
"Phenolic acid decarboxylase (EC 4.1.1.-)" (EC 4.1.1.-)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Ascorbate and aldarate metabolism
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Fluorene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Purine metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.-
Use Curated BLAST to search for 4.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385XYF4 at UniProt or InterPro
Protein Sequence (168 amino acids)
>DZA65_RS11330 phenolic acid decarboxylase (Dickeya dianthicola ME23) MSSFDKQDLSGFVGKHLVYTYDNGWNYEIYVKNDHTLDYRIHSGIVANRWVKDQQVFIAR VAHDVYKISWTEPTGTDVSLIINLGDRIFHGTIFFPRWVINNPEKTVCFQNDHIPLMESY RAAGPAYPTEVIDEFATITFVRDCGENNNNVINCPASDLPDNFPLNLR