Protein Info for DZA65_RS11330 in Dickeya dianthicola ME23

Annotation: phenolic acid decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF05870: PA_decarbox" amino acids 9 to 164 (156 residues), 288.8 bits, see alignment E=8.9e-91 PF22036: MoaF_like" amino acids 13 to 97 (85 residues), 29.2 bits, see alignment E=6.9e-11

Best Hits

Swiss-Prot: 60% identical to PADC_VIBCH: Probable phenolic acid decarboxylase (padC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K13727, phenolic acid decarboxylase [EC: 4.1.1.-] (inferred from 96% identity to dze:Dd1591_2088)

Predicted SEED Role

"Phenolic acid decarboxylase (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYF4 at UniProt or InterPro

Protein Sequence (168 amino acids)

>DZA65_RS11330 phenolic acid decarboxylase (Dickeya dianthicola ME23)
MSSFDKQDLSGFVGKHLVYTYDNGWNYEIYVKNDHTLDYRIHSGIVANRWVKDQQVFIAR
VAHDVYKISWTEPTGTDVSLIINLGDRIFHGTIFFPRWVINNPEKTVCFQNDHIPLMESY
RAAGPAYPTEVIDEFATITFVRDCGENNNNVINCPASDLPDNFPLNLR