Protein Info for DZA65_RS11305 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 262 (170 residues), 47.7 bits, see alignment E=7.9e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 96% identity to ddd:Dda3937_01639)

Predicted SEED Role

"Putative ABC transporter of substrate X, permease subunit II" in subsystem ABC transporter of unknown substrate X

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7R8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>DZA65_RS11305 ABC transporter permease (Dickeya dianthicola ME23)
MQQTVIDRLNRLLVVVLLLLGTVWLILPFAMAVLWSLVDPSHPWAYPDVFPPVLSLLRWR
ELWNNTSLPDALLHSYLLAPMVTLTCLLLAMPTAYAFGRLSFPGKGLAQTLTLLPIVLPG
FVVAVFFSSLLTRLGFYSRFMGIFLGHTVLFLPYAIRILSVSFSQVRQDLVDAARNLGAS
RREVFRVAYWPALQSGVMAAMIMVFILSIEEFSVSYIVGAPDFITVPTILYSYLGYNFIR
PNAAVVSLILVVPNVLLMLLMERCLKHVPASAFVNKG