Protein Info for DZA65_RS11300 in Dickeya dianthicola ME23

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 308 (266 residues), 40.8 bits, see alignment E=5.6e-14 PF13531: SBP_bac_11" amino acids 45 to 312 (268 residues), 33.1 bits, see alignment E=1e-11 PF13416: SBP_bac_8" amino acids 49 to 316 (268 residues), 72.3 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K05777, putative thiamine transport system substrate-binding protein (inferred from 91% identity to ddd:Dda3937_01640)

Predicted SEED Role

"Possible ABC transporter, periplasmic substrate X binding protein precursor" in subsystem ABC transporter of unknown substrate X

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXQ6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>DZA65_RS11300 extracellular solute-binding protein (Dickeya dianthicola ME23)
MLLLALPQVQAQTPDLSTMSWQAVEAQARQEGQLTWFNWYYQDRLREEVKVFEKQYGIRV
TIPDGEAAASINKLLAEQHREQGDIDVISVGGSQFGQLNGPKLFWGPLSARLPAGDTLSY
QIEGGDTRGYAVAFWGNQTVIAYNSARITAAELPHSLPQFEQFLVKNPGEFAFNVENGGA
GPGFVESVTRALVTDVNYRDGKAAPEILQRLAPSWRWFNRYKNSLVISASNADSITRLNA
GEFKLVASWEDLVLSLQHKGEVSPDIKFYLPEFGMPGGGNVVGIPANAKHKAAALLFIHW
LTQPDTQQRFHSQFGTALLTPAGDGTQAADSLDRSRSFAWAAKPLGDEIKKQFIQNVMLK