Protein Info for DZA65_RS11185 in Dickeya dianthicola ME23

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 2 to 320 (319 residues), 137.8 bits, see alignment E=2.3e-44

Best Hits

KEGG orthology group: None (inferred from 78% identity to ddd:Dda3937_04140)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XY41 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DZA65_RS11185 acyltransferase family protein (Dickeya dianthicola ME23)
MEWLYIARIFSTFAVIVLHVSAYTVALAELGTFPWWAGNLYDSLVRWCVPVFIMISGALL
LSPEKVDSLSDFYKKRMMKIVIPLLFWSLLFIFIGIVKSRFNGEGEDNILKNIINGRPYY
HMWFLYMIIGLYVFTPLIRILIVNAREETLLFFVFLMFVFCSLNDMYNFLIGNRDFLFIS
EFIYYIPYYICGHLIARKSTTKPLSFYVFLFLVSLILTCTCCYLLSSIAGKGVGLYFYNY
LSFNVILMSISFMWILKFFHLKQSHNNKLKFFSDISLGIYLIHPVFIEFFYYLAAKRWIY
YSAISIPLMSIMVFSCCVIAVFFIKRIPYLRKVV