Protein Info for DZA65_RS11155 in Dickeya dianthicola ME23

Annotation: DUF1283 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF06932: DUF1283" amino acids 29 to 118 (90 residues), 132.3 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 52% identical to Y2049_PECCP: UPF0482 protein PC1_2049 (PC1_2049) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_04133)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXE0 at UniProt or InterPro

Protein Sequence (118 amino acids)

>DZA65_RS11155 DUF1283 family protein (Dickeya dianthicola ME23)
MQKKTRNLLLLFTSSLLSLSLWQSAQAAQHIIIDNGNSALSKEAARQSSEDWNETRTLRN
KLNKHLEKRVDKADRDFDKADMAQALEEKCKGSSNFNAYWEPSSSRCLDRRSGRQVTP