Protein Info for DZA65_RS11120 in Dickeya dianthicola ME23

Annotation: mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF20511: PMI_typeI_cat" amino acids 1 to 150 (150 residues), 136.3 bits, see alignment E=1.7e-43 TIGR00218: mannose-6-phosphate isomerase, class I" amino acids 2 to 384 (383 residues), 384 bits, see alignment E=3.7e-119 PF20512: PMI_typeI_hel" amino acids 157 to 236 (80 residues), 51.6 bits, see alignment E=2.2e-17 PF21621: MPI_cupin_dom" amino acids 311 to 389 (79 residues), 91.2 bits, see alignment E=6.4e-30 PF01238: PMI_typeI_C" amino acids 311 to 355 (45 residues), 30.8 bits, see alignment 5.3e-11

Best Hits

Swiss-Prot: 71% identical to MANA_ECOLI: Mannose-6-phosphate isomerase (manA) from Escherichia coli (strain K12)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 96% identity to ddd:Dda3937_04125)

MetaCyc: 71% identical to mannose-6-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Mannose-6-phosphate isomerase. [EC: 5.3.1.8]

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C843 at UniProt or InterPro

Protein Sequence (394 amino acids)

>DZA65_RS11120 mannose-6-phosphate isomerase (Dickeya dianthicola ME23)
MQKMRNSVQNYAWGSKHALTELYGIENPGNLPMAELWMGAHPKSSSLLLDEQGQAHNLRE
LINSDRPGFLGNAVAQRFGELPFLFKVLCAEQPLSIQVHPNKSAAEAGFERENAAGIALD
SPQRNYKDANHKPELVFALTSYLAMNGFRELAEIARLLQPLADAHPAIAAFLQHPNSQTL
TTLFSSLLSMNGEQKAQAIAELNRVLDSQHGDPWDTIRFIAQFYPDDGGLFSPLLLNVVT
LKPGEAMFLYAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELLANVRFESKPAAS
LLTSPIKTANELSFPIPVDDFAFSLHYLTDAPQTLSQQSAAIVFCVEGQAVLEKGAQQVT
LLPGESCFIPAGESPVQVQGQGQIARVYNRPLMV