Protein Info for DZA65_RS11105 in Dickeya dianthicola ME23

Annotation: SgcJ/EcaC family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02246: conserved hypothetical protein" amino acids 32 to 150 (119 residues), 42.3 bits, see alignment E=3.5e-15 PF08332: CaMKII_AD" amino acids 33 to 150 (118 residues), 54.1 bits, see alignment E=3.7e-18 PF14534: DUF4440" amino acids 36 to 141 (106 residues), 33.6 bits, see alignment E=9.4e-12 PF13474: SnoaL_3" amino acids 36 to 148 (113 residues), 29.9 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to dze:Dd1591_2143)

Predicted SEED Role

"FIG00613169: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C4V4 at UniProt or InterPro

Protein Sequence (152 amino acids)

>DZA65_RS11105 SgcJ/EcaC family oxidoreductase (Dickeya dianthicola ME23)
MYKKVLLSLSLLSAAITSQAYAANTETCVKTDEKTIASLFDRWNTSLQTGDAKKVNANYA
TDAVLLPTLSSKVRKTDAERIDYFEHFLPKKPVGSIDDRVIKIGCNEALDTGNYTFTFGD
KSQAKARYTYTYAFKDGKWLITSHHSSVQPKD