Protein Info for DZA65_RS11050 in Dickeya dianthicola ME23

Annotation: electron transport complex subunit RsxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 2 to 189 (188 residues), 277.5 bits, see alignment E=2.2e-87 PF04060: FeS" amino acids 44 to 76 (33 residues), 51.7 bits, see alignment 2.3e-17 PF14697: Fer4_21" amino acids 109 to 163 (55 residues), 67.2 bits, see alignment E=4.7e-22 PF00037: Fer4" amino acids 110 to 131 (22 residues), 29.3 bits, see alignment (E = 2.1e-10) amino acids 140 to 162 (23 residues), 25.2 bits, see alignment (E = 4.2e-09) PF12837: Fer4_6" amino acids 111 to 131 (21 residues), 25 bits, see alignment (E = 5.4e-09) PF13187: Fer4_9" amino acids 115 to 161 (47 residues), 27.4 bits, see alignment E=1.1e-09 PF12838: Fer4_7" amino acids 115 to 160 (46 residues), 27.5 bits, see alignment 1.5e-09

Best Hits

Swiss-Prot: 77% identical to RNFB_PECCP: Ion-translocating oxidoreductase complex subunit B (rnfB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 94% identity to ddd:Dda3937_00594)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXA4 at UniProt or InterPro

Protein Sequence (196 amino acids)

>DZA65_RS11050 electron transport complex subunit RsxB (Dickeya dianthicola ME23)
MITIWIAIAALSALALVFGSILGFASRRFQVEEDPVIEQLEAMLPQSQCGQCGYPGCRPY
AEAIALNNEHINKCVPGGEPLMRKLAERLNVDPQPLDAEAPQKPEPLVAWVDEGNCIGCT
KCIQACPVDAIVGTTRAVHTVIRDLCTGCNLCVPPCPTDCIELRPLAPTTASWKWNLDAI
PVRVIQTENRVIENHV