Protein Info for DZA65_RS11045 in Dickeya dianthicola ME23

Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 446 (434 residues), 596.3 bits, see alignment E=1.4e-183 PF13375: RnfC_N" amino acids 14 to 115 (102 residues), 96.7 bits, see alignment E=4.7e-31 PF01512: Complex1_51K" amino acids 140 to 283 (144 residues), 152.8 bits, see alignment E=4.3e-48 PF10531: SLBB" amino acids 296 to 345 (50 residues), 29.2 bits, see alignment 4.2e-10 PF13237: Fer4_10" amino acids 373 to 428 (56 residues), 36.6 bits, see alignment 2.3e-12 PF13183: Fer4_8" amino acids 376 to 431 (56 residues), 35.2 bits, see alignment 9.6e-12 PF00037: Fer4" amino acids 376 to 391 (16 residues), 22.3 bits, see alignment (E = 5.8e-08) PF13187: Fer4_9" amino acids 377 to 430 (54 residues), 29.9 bits, see alignment 3e-10 PF12800: Fer4_4" amino acids 377 to 391 (15 residues), 16.3 bits, see alignment (E = 6.7e-06) amino acids 416 to 428 (13 residues), 15.6 bits, see alignment (E = 1.1e-05) PF12838: Fer4_7" amino acids 378 to 431 (54 residues), 41.3 bits, see alignment 1.1e-13 PF13534: Fer4_17" amino acids 403 to 431 (29 residues), 24.1 bits, see alignment (E = 2.8e-08)

Best Hits

Swiss-Prot: 74% identical to RNFC_PECAS: Ion-translocating oxidoreductase complex subunit C (rnfC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 87% identity to dze:Dd1591_2156)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZK3 at UniProt or InterPro

Protein Sequence (587 amino acids)

>DZA65_RS11045 electron transport complex subunit RsxC (Dickeya dianthicola ME23)
MFKLFAAFRKNRIWDFSGGIHPPEMKIHSSRVPLRQVPMPGYLIIPLKQHLGPEGDLCVK
AGDPVLRGQPLTRGAGRMLPVHAPTSGTVHAIRQHMSNHPSGLTELSIIIIPDGQDRWCE
RRPLVDYRQATPSELVELLHQAGIAGLGGAGFPTAAKLQGGLHGINTLIINAAECEPYIT
ADDRLMQECAQEIVQGIDILDHLLQPQRILLGIEDNKPEAIAALRVALVDYPHIQMRVIP
TKYPSGGAKQLTRILTGKEVPFGKHSASIGILMQNVGTAYAIKRAIINGEPLTERVVTLT
GNALRQPGNVWARLGTPVRHLLRHAGYHVTTTQPMVIMGGPLMGFTLPALDVPIIKISNC
ILAPARDEIQAQEEEQACIRCGKCADVCPAGLLPQQLYWFSRGQEHEKARQHHLFDCIEC
GACAYVCPSNIPLVQYYRQEKAEIQALDQESRKATEAKVRFDARQVRLEREKQAREQRHK
QAAASVASTDKNAVMAALERVRNKQATAIQADIRIEPGQQPDNRAVIAAREARKAQAREH
QAATSPAEPAPAVATNDDADPRKAAVAAAIARVNARKAAASQAPQED