Protein Info for DZA65_RS11030 in Dickeya dianthicola ME23

Annotation: electron transport complex subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 199 (194 residues), 222.5 bits, see alignment E=2e-70 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 7 to 209 (203 residues), 283.5 bits, see alignment E=3.9e-89

Best Hits

Swiss-Prot: 80% identical to RNFE_YERPY: Ion-translocating oxidoreductase complex subunit E (rnfE) from Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 97% identity to ddd:Dda3937_00590)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C3U5 at UniProt or InterPro

Protein Sequence (234 amino acids)

>DZA65_RS11030 electron transport complex subunit E (Dickeya dianthicola ME23)
MNQTNELALQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLICTNIAVSALR
RWVPDEIRIPIYVLLIASVVTIVQMLINAYAYGLYQSLGIFIPLIVTNCIVIGRAEAFAS
KNTVMLSALDGLFMGLGATSALFVLGAIREILGNGTLFDGADLLLGGWARVLRVEVVHMD
SPFLLMILPPGAFIGLGMMLAAKYLIDEKRKRRHARTVRLSPLGSSTGSSTLTE