Protein Info for DZA65_RS10980 in Dickeya dianthicola ME23

Annotation: 23S rRNA pseudouridine(2605) synthase RluB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF01479: S4" amino acids 4 to 44 (41 residues), 39.8 bits, see alignment 2.9e-14 PF00849: PseudoU_synth_2" amino acids 69 to 200 (132 residues), 72.7 bits, see alignment E=4e-24 TIGR00093: pseudouridine synthase" amino acids 73 to 232 (160 residues), 201 bits, see alignment E=4.9e-64

Best Hits

Swiss-Prot: 79% identical to RLUB_YERPE: Ribosomal large subunit pseudouridine synthase B (rluB) from Yersinia pestis

KEGG orthology group: K06178, ribosomal large subunit pseudouridine synthase B [EC: 5.4.99.12] (inferred from 99% identity to ddd:Dda3937_00580)

MetaCyc: 80% identical to 23S rRNA pseudouridine2605 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11836 [EC: 5.4.99.22]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXF3 at UniProt or InterPro

Protein Sequence (296 amino acids)

>DZA65_RS10980 23S rRNA pseudouridine(2605) synthase RluB (Dickeya dianthicola ME23)
MSEKLQKVLARAGHGSRREIESMIEAGRISVDGKIATLGDRVEVTRATKIRLDGHVVSVR
ETEETVCRVLMYYKPEGELCTRSDPEGRPTVFDRLPRIQGYRWVAVGRLDVNTSGLLLFT
TDGELANRLMHPSREVEREYAVRVFGEVGDDKIRQLSKGVQLEDGPAAFRSIRYQGGEGL
NQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIQLPKGVPRGGWMEMGLTDVNYL
RELVQLTPETVSKLPVERERRRVKANQIRRAVKRHSQVGVSNRPASGRRSAPKRNG