Protein Info for DZA65_RS10960 in Dickeya dianthicola ME23

Annotation: C26 family cysteine hydrolase domain-containing family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 4 to 187 (184 residues), 176.8 bits, see alignment E=2.1e-56 PF00117: GATase" amino acids 5 to 186 (182 residues), 174.2 bits, see alignment E=2.6e-55 PF07722: Peptidase_C26" amino acids 72 to 172 (101 residues), 28.4 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 81% identical to TRPG_YERPE: Anthranilate synthase component 2 (trpG) from Yersinia pestis

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 97% identity to ddd:Dda3937_00576)

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXI4 at UniProt or InterPro

Protein Sequence (192 amino acids)

>DZA65_RS10960 C26 family cysteine hydrolase domain-containing family (Dickeya dianthicola ME23)
MADILLLDNIDSFTYNLVDQLRASGHNVVVYRNQLPADVITDRLRHLEKPVLMLSPGPGT
PSEAGCMPALLQRLRGQLPIIGICLGHQAIVEAYGGHVGQAGEILHGKASSVEHDSQAMF
SGLPSPLPVARYHSLVGSNIPAGLVINASFNGMVMAVRHDEHRVCGFQFHPESILTTHGA
RLLNQTLDWALA