Protein Info for DZA65_RS10915 in Dickeya dianthicola ME23

Annotation: septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 175 (175 residues), 217.4 bits, see alignment E=8.2e-69 PF04279: IspA" amino acids 1 to 175 (175 residues), 232 bits, see alignment E=2.7e-73

Best Hits

Swiss-Prot: 75% identical to YCIB_PECCP: Probable intracellular septation protein A (PC1_1997) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06190, intracellular septation protein (inferred from 95% identity to ddd:Dda3937_00567)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CUA2 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DZA65_RS10915 septation protein A (Dickeya dianthicola ME23)
MKQLIDFIPLIVFFACYKLYDIYVASGALIAATAAALLLSWFIYRKIEKMMLLTFLMVAV
FGTLTLVFHNDQFIKWKVTIIYMLFAIALLFSQFVMKKILIQRMLGKDLSLPEMVWAKLN
ISWAVFFLLCGLTNIYIAFWLPQSVWVDFKVFGLTGLTLVFTLLCGVYIYRHLPAEPAKT
ENESDK