Protein Info for DZA65_RS10850 in Dickeya dianthicola ME23

Annotation: YchE family NAAT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 8 to 206 (199 residues), 257.5 bits, see alignment E=4.4e-81 PF01914: MarC" amino acids 9 to 210 (202 residues), 243.4 bits, see alignment E=7.8e-77

Best Hits

Swiss-Prot: 78% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ddd:Dda3937_04055)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXG2 at UniProt or InterPro

Protein Sequence (214 amino acids)

>DZA65_RS10850 YchE family NAAT transporter (Dickeya dianthicola ME23)
MIQPVLDFSGYIKFFIGLFALINPVGILPIFISMTNYQGAEGRAKTNLTANVSVVIILWG
ALFFGDMILRLFGISIDSFRIAGGILIVTIAMSMISGKLGEDKQNKQEKTETANRESIGV
VPLALPLMAGPGAISSTIVWSSRYHGWQNLLGLSAAIAFFAFCCWLLFRAAPALVRLLGQ
TGINVVTRIMGLLLMSLGIEFIVTGIRTLFPGLL