Protein Info for DZA65_RS10585 in Dickeya dianthicola ME23

Annotation: bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 9 to 209 (201 residues), 283.7 bits, E=3.3e-89
• PF01081: Aldolase
  • amino acids 9 to 203 (195 residues), 298.9 bits, E=7.1e-94

Best Hits

Swiss-Prot: 100% identical to ALKH_DICD3: KHG/KDPG aldolase (eda) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to dze:Dd1591_2243)

MetaCyc: 100% identical to 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (Dickeya dadantii 3937)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• superpathway of hexuronide and hexuronate degradation (9/10 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• D-galacturonate degradation I (5/5 steps found)
• D-fructuronate degradation (4/4 steps found)
• superpathway of β-D-glucuronosides degradation (6/7 steps found)
• D-galactonate degradation (3/3 steps found)
• Entner-Doudoroff shunt (1/2 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• D-glucosaminate degradation (1/3 steps found)
• L-glucose degradation (3/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

See A0A3A4C4L4 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DZA65_RS10585 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (Dickeya dianthicola ME23)
MKNWKTSAEQILTAGPVVPVIVINKLEHAVPMAKALVAGGVRVLELTLRTDCAVEAIRLI
AQEVPDAIVGAGTVTNPQQLAEVTAAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLREFKFFPAEANGGVKALQAIAGPFGKIRFCPTGGISLKNYRDYLALKSVLC
VGGSWLVPADALESGDYDRITALAREAVAGATA