Protein Info for DZA65_RS10465 in Dickeya dianthicola ME23

Annotation: copper homeostasis protein CutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF03932: CutC" amino acids 4 to 200 (197 residues), 250.3 bits, see alignment E=6e-79

Best Hits

Swiss-Prot: 74% identical to CUTC_PECCP: Copper homeostasis protein CutC (cutC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06201, copper homeostasis protein (inferred from 94% identity to ddd:Dda3937_01608)

Predicted SEED Role

"Cytoplasmic copper homeostasis protein cutC" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX27 at UniProt or InterPro

Protein Sequence (254 amino acids)

>DZA65_RS10465 copper homeostasis protein CutC (Dickeya dianthicola ME23)
MPMLEVCCYSLDCALTAQQAGADRVELCAAQREGGLTPGYGVLRLARETLAIPVHPMVRP
RGGDFCYSHQEFTAMLYDIDQIRAMGFPGLVVGILDEEGHIDLTRMKQVMARCEGMAVTF
HRAFDMCLNPRLALNQLADLGIARVLTSGQQQSAENGLTLLRELNAANCGPIIMAGAGVR
LTNLHKFRACGIQELHTSAGQWLPSPMRYRKLGVTLCSETEMDEFRHYCVDGDVVAAMKN
ALSLEPAPSATSAS