Protein Info for DZA65_RS10230 in Dickeya dianthicola ME23

Annotation: chromosome partition protein MukE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF04288: MukE" amino acids 12 to 233 (222 residues), 405.3 bits, see alignment E=4.8e-126 PF21980: MksE" amino acids 22 to 192 (171 residues), 170.6 bits, see alignment E=3.7e-54

Best Hits

Swiss-Prot: 86% identical to MUKE_PECAS: Chromosome partition protein MukE (mukE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03804, chromosome partition protein MukE (inferred from 95% identity to ddd:Dda3937_03196)

Predicted SEED Role

"Chromosome partition protein MukE" in subsystem DNA structural proteins, bacterial or MukBEF Chromosome Condensation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XX31 at UniProt or InterPro

Protein Sequence (240 amino acids)

>DZA65_RS10230 chromosome partition protein MukE (Dickeya dianthicola ME23)
MSSINIDQHVFARLMTALSNTLFPALDSQLRAGRHIGVEELENHVFLMDFQDELEQFYGR
YNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPERLAHEGIFSQQEL
YDELLSLADENKLLKLVNQRSTGSDLDRQKLQEKVRTSLNRLRRLGMIYFMGTDNSKFRI
TEAVFRFGADVRGGDDPREAQLRMIRDGEAMPVDGSLSLEDSDDGDNASSDDQRAEDEQE