Protein Info for DZA65_RS10120 in Dickeya dianthicola ME23

Annotation: citrate lyase holo-[acyl-carrier protein] synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03124: holo-ACP synthase CitX
  • amino acids 7 to 170 (164 residues), 200 bits, E=1.3e-63
• PF03802: CitX
  • amino acids 7 to 170 (164 residues), 187.8 bits, E=6.5e-60

Best Hits

Swiss-Prot: 43% identical to CITX_CITK8: Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (citX) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K05964, holo-ACP synthase [EC: 2.7.7.61] (inferred from 94% identity to ddd:Dda3937_04564)

MetaCyc: 43% identical to apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (Escherichia coli K-12 substr. MG1655)
Citrate lyase holo-[acyl-carrier-protein] synthase. [EC: 2.7.7.61]

Predicted SEED Role

"Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.61)" (EC 2.7.7.61)

MetaCyc Pathways

• citrate lyase activation (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.61

Sequence Analysis Tools

See A0A385XXR8 at UniProt or InterPro

Protein Sequence (175 amino acids)

>DZA65_RS10120 citrate lyase holo-[acyl-carrier protein] synthase (Dickeya dianthicola ME23)
MDTPVAVSLESLLAAKERRYARQQQLLARHHSTLVSLTLVTPGPVKDSPPYRRAMAEAVT
AFNDLCLARGWEALEQQLHWLDTGAEAFWVITKDALSVKAAAITVEDQHPLGRLWDFDVF
CPQEGSISRTLLAHDRRRCILCDESAHVCARSRRHALPDVIEKIESILHAWFNAH