Protein Info for DZA65_RS10090 in Dickeya dianthicola ME23

Annotation: 2-hydroxycarboxylate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 183 to 210 (28 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details amino acids 433 to 454 (22 residues), see Phobius details PF03390: 2HCT" amino acids 34 to 447 (414 residues), 465.5 bits, see alignment E=6.4e-144

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_2264)

Predicted SEED Role

"Citrate/acetate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXR1 at UniProt or InterPro

Protein Sequence (455 amino acids)

>DZA65_RS10090 2-hydroxycarboxylate transporter family protein (Dickeya dianthicola ME23)
MSTTDDSYIVVKDEASGKVSLKEKWWHVLDNYKIGVIPVPLFILAGLLIALDCVEGKLPS
DIVVMVATLAFFGFACGEFGKRLPLIGKMGAAAICATFIPSALVYYGLLPQVVVDSTTKF
YKSTNILYLYICCIIVGSIMSMNRQTLIQGFLRIFFPMLCGEVVGMIVGMGVGIMLGMDP
FQIFFFLVLPIMAGGVGEGAIPLSIGYAALLHMEQGVALGRILPIVMLGSLTAIVLAGAL
NQLGKRYPHLTGEGDLMPNKPNDTAQASASLTSSLSGKMDPANLAAGALLAILLYMIGML
GYKLIGLPAPVGMLFAAVIVKLLNGASPRLLEGSQVVYKFFQTSVTYPILFAVGVAITPW
EELVHAFTITNLLVIVSTVVALVTTGFFVGKKIGMHPIDVAIISCCQSGQGGTGDVAILT
AGNRMALMPFAQIATRIGGAINVSVALLVLGKFLV