Protein Info for DZA65_RS10060 in Dickeya dianthicola ME23

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR00070: ATP phosphoribosyltransferase" amino acids 7 to 197 (191 residues), 189.1 bits, see alignment E=7.1e-60 PF01634: HisG" amino acids 54 to 219 (166 residues), 169 bits, see alignment E=7.9e-54 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 203 to 298 (96 residues), 106 bits, see alignment E=9.6e-35 PF08029: HisG_C" amino acids 223 to 296 (74 residues), 78.1 bits, see alignment E=4.4e-26

Best Hits

Swiss-Prot: 97% identical to HIS1_PECAS: ATP phosphoribosyltransferase (hisG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 99% identity to ddd:Dda3937_02972)

MetaCyc: 90% identical to ATP phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
ATP phosphoribosyltransferase. [EC: 2.4.2.17]

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XXI7 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DZA65_RS10060 ATP phosphoribosyltransferase (Dickeya dianthicola ME23)
MLDKTRLRIAMQKSGRLSDDSRELLARCGIKINLHQQRLIAFAENMPIDILRVRDDDIPG
LVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLAMQLDEEYTGPQ
CLQNKRIATSYPHLLKQYLDKQGVNFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN
GLREVEVIYRSKACLIQRDGEMPAEKQQLIDKLLTRMQGVIQARESKYIMLHAPSERLDE
IIALLPGAERPTILPLAGAQNRVAMHMVSSETLFWETMEKLKLLGASSILVLPIEKMME