Protein Info for DZA65_RS09855 in Dickeya dianthicola ME23

Annotation: DUF2867 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 233 to 252 (20 residues), see Phobius details amino acids 439 to 462 (24 residues), see Phobius details PF01370: Epimerase" amino acids 8 to 116 (109 residues), 41.4 bits, see alignment E=1.8e-14 PF13460: NAD_binding_10" amino acids 12 to 149 (138 residues), 33.1 bits, see alignment E=7.8e-12 PF11066: DUF2867" amino acids 336 to 465 (130 residues), 49.2 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 58% identical to YBJT_ECOLI: Putative NAD(P)-binding protein YbjT (ybjT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to dze:Dd1591_2373)

Predicted SEED Role

"FIG00613927: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWX0 at UniProt or InterPro

Protein Sequence (488 amino acids)

>DZA65_RS09855 DUF2867 domain-containing protein (Dickeya dianthicola ME23)
MTIRPAPILILGASGYIGRHLLMRLSQQGQTVIAASRHIDSLAALNLPGIRCEYVDLMKP
YTLPEGLWQTDTLYYLAHSMGDGADFLEREYQSAQNLRQVLRTSRIRQIIYLGSVQAEHH
PSIHMQARKLTGDILRSSGIPVTELRAGIIVGPGSAAFEILRDMVNNLPVLTPPRWVRSK
SAPIALENLLTYLTELRHYPTERHRTFDAAGPEYLSYLALFERFIRITGKRRLLLPIPVP
TGLISAWFLNMVTSVSSSTARALVQGLRHDLPMDDGELRRLIPLRLIGFDEAVRTTLADE
KAAAQHPDWGYDPDVQARWQPNYAFYPKQAGYSHKTGASSQALWQIIQQVGGREGYFYAN
LLWTIRARIDDLCGNQVIYRRPERAELMEGDFVNGWKVIRARPHQQLVLLFGMKAPGLGR
LVFSIDDRGAYRVLDVRAWWHPAGCNGLVYWFLMMPAHLFIFRGMARRIAALAQEAEHRD
IVQLPHSD