Protein Info for DZA65_RS09825 in Dickeya dianthicola ME23

Annotation: arginine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 3 to 243 (241 residues), 282.9 bits, see alignment E=1.2e-88 PF00497: SBP_bac_3" amino acids 25 to 244 (220 residues), 138.1 bits, see alignment E=7.7e-45

Best Hits

Swiss-Prot: 77% identical to ARTJ_ECOLI: ABC transporter arginine-binding protein 1 (artJ) from Escherichia coli (strain K12)

KEGG orthology group: K09996, arginine transport system substrate-binding protein (inferred from 92% identity to dze:Dd1591_2380)

MetaCyc: 77% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtJ" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CX30 at UniProt or InterPro

Protein Sequence (246 amino acids)

>DZA65_RS09825 arginine ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKKLILAALLASATMTFNATAADTIRFAASATYPPFESLDAGNQIVGFDIDLANALCKQL
QATCSFTNQAFDSLIPALKFRRYDAVISGMDITPERSKQVAFTQPYYANSAIVIAQKGKF
HSLADLKGKRIGMENGTTHQKFLQDTHPEVKTVPYDSYQNALIDLKNGRLDGVFGDTAVV
NEWLKTNPDLATVGEKVTDPAYFGIGLGIAVRPDNQPLLEKLNGALNAIKANGTYKALND
KWFPQQ